PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_F23D9EA93.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 225aa    MW: 23300.7 Da    PI: 6.018
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_F23D9EA93.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.41.9e-5720115297
                  NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 
                            +eqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedy+eplk+yl+k
  Traes_2BS_F23D9EA93.1  20 KEQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYMEPLKLYLHK 107
                            79************************************************************************************** PP

                  NF-YB  90 yrelegek 97 
                            +relegek
  Traes_2BS_F23D9EA93.1 108 FRELEGEK 115
                            ******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-5317119IPR009072Histone-fold
SuperFamilySSF471132.33E-4022138IPR009072Histone-fold
PfamPF008087.4E-282589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-205371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-207290No hitNo description
PRINTSPR006151.7E-2091109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MPDSDNDSGG PSNADFSSPK EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF  60
ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYMEP LKLYLHKFRE LEGEKAVGAG  120
GVGALPSPGG SGSQQRESTP RNNGGGGEAG GYGGMYGGAG AGGGGGGMFM MMGQPMYGSP  180
PAAGYQHPQH HHQMMTGGQG GYGYGDAGAG GGSSSSSGFG RQDRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4820110292Transcription factor HapC (Eurofung)
4g92_B1e-4820110292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7646000.0JF764600.1 Hordeum vulgare NF-YB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463163.14e-88hypothetical protein SORBIDRAFT_02g038870
SwissprotO233103e-72NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLW5BQ071e-163W5BQ07_WHEAT; Uncharacterized protein
STRINGMLOC_70684.11e-106(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-68nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]